PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA643G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 243aa    MW: 28227.7 Da    PI: 8.9149
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA643G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l d++  +G g W+t ++  g++R++k+c++rw +yl
      AA643G00001 15 RGAWTDHEDKILRDYILTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYL 62
                     89********************************************97 PP

2Myb_DNA-binding54.23.3e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
      AA643G00001  68 RGNISPDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 112
                      7899******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6581062IPR017930Myb domain
SuperFamilySSF466894.4E-2813109IPR009057Homeodomain-like
SMARTSM007179.0E-121464IPR001005SANT/Myb domain
PfamPF002492.8E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-221669IPR009057Homeodomain-like
CDDcd001673.73E-81762No hitNo description
PROSITE profilePS5129425.41663117IPR017930Myb domain
SMARTSM007173.3E-1667115IPR001005SANT/Myb domain
PfamPF002492.2E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2470117IPR009057Homeodomain-like
CDDcd001671.50E-1072110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRRTSNVKR EELNRGAWTD HEDKILRDYI LTHGEGKWST LPNQAGLKRC GKSCRLRWKN  60
YLRPGIKRGN ISPDEEELII RLHNLLGNRW SLIAGRLPGR TDNEIKNHWN SNLRKRLLNN  120
KNKNKNSVCA IRTKAVRGSK AILFSDLPNE KETTNPLRLQ FHKPEETIAV NDGSSLLGDL  180
EFDFDRIQIF PELMDFDGLT CGNVTSDEFL GDWNSSQENL DLNRPFASYL QRDDENWLRD  240
FSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-26411716128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198405.11e-119transcription factor TT2
SwissprotQ9FJA21e-121TT2_ARATH; Transcription factor TT2
TrEMBLD7MHT11e-118D7MHT1_ARALL; Putative uncharacterized protein
STRINGAT5G35550.11e-118(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-112MYB family protein